Home Tools
Log in
Cart

Search Result

Search Results for " exendin4 acetate "

3

Compounds

Cat No. Product Name Synonyms Targets
T8748 Exendin-4 acetate Glucagon Receptor
Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).
T3967 Exendin-4 Exenatide,Exenatide Acetate Glucagon Receptor
Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.
TP1154 Exendin-4 peptide derivative acetate GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.
TargetMol